PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco017563.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family MIKC_MADS
Protein Properties Length: 248aa    MW: 28158 Da    PI: 8.7473
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco017563.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.41e-29959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 krienk+ rqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++g+l+e++s
  Aco017563.1  9 KRIENKISRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGRLFEFCS 59
                 79***********************************************96 PP

2K-box100.32.7e-33791736100
        K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                  + ++ +++++s +qe+ kLk ++e Lq++qR+llGedL +Ls +eL++Le+qLekslk+iRs+K++++l+++++l+ ke++lqe+n++L+++l+e
  Aco017563.1  79 KAAVPATETQSNYQEYLKLKMRVEILQQSQRNLLGEDLIPLSSNELEHLENQLEKSLKQIRSRKTQVMLDELSDLKTKEQMLQEANRSLKRELQE 173
                  44488999***********************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.3E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.716161IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.01E-32280IPR002100Transcription factor, MADS-box
CDDcd002655.94E-42276No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-31323IPR002100Transcription factor, MADS-box
PfamPF003192.0E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-313859IPR002100Transcription factor, MADS-box
PfamPF014862.2E-2785171IPR002487Transcription factor, K-box
PROSITE profilePS5129715.90487177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MGRGRVELKR IENKISRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGRLFEFCSS  60
SSILKTLERY QRHTYAASKA AVPATETQSN YQEYLKLKMR VEILQQSQRN LLGEDLIPLS  120
SNELEHLENQ LEKSLKQIRS RKTQVMLDEL SDLKTKEQML QEANRSLKRE LQEADLQDPL  180
LLSWENGTGG ASNVACNQRP SQSSQGFFHP IPFEPSLQIG YYPMYTNQLN AADATTGENV  240
YPPGWIG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A8e-2775168198Developmental protein SEPALLATA 3
4ox0_B8e-2775168198Developmental protein SEPALLATA 3
4ox0_C8e-2775168198Developmental protein SEPALLATA 3
4ox0_D8e-2775168198Developmental protein SEPALLATA 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6646741e-148KM664674.1 Ananas bracteatus clone 49656a microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010257958.11e-116PREDICTED: developmental protein SEPALLATA 1
SwissprotQ386945e-97AGL9_ARADE; Agamous-like MADS-box protein AGL9 homolog
TrEMBLQ5K6A21e-110Q5K6A2_ELAGV; MADS box transcription factor
STRINGVIT_01s0011g00110.t011e-102(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22213264
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02310.17e-90MIKC_MADS family protein